- Recombinant Rat Protein lifeguard 2 (Faim2)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1221802
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 35,036 Da
- E Coli or Yeast
- 1-316
- Fas apoptotic inhibitory molecule 2
- Lfg, NMP35
- Protein lifeguard 2 (Faim2)
Sequence
MTQGKLSVANKAPGTEGQQQANGEKKDAPAVPSAPPSYEEATSGEGLKAGAFPQGPTAVPLHPSWAYVDPSSSSGYEGGFPAGHHELFSTFSWDDQKVRQLFIRKVYTILLVQLLVTLAVVALFTFCDVVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTIFTLSMAYLTGMLSSYYNTTSVLLCLGITALVCLSVTIFSFQTKFDFTSCHGVLFVLLMTLFFSGLLLAILLPFQYVPWLHAVYAVLGAGVFTLFLAFDTQLLMGNRRHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNRE